Orf Name: Smlt0027
Type: Transposase


Previous Annotation: putative_ISXac3_related_insertion_element

Borders:
putative transposase <---> putative ISXac3 like transposase


Protein fasta sequence
MSKRRKFSTEFKRGAVEQASQPGVSCAQVARELGIRDALLTRWKREAQSR
GQVAFGGTGTPRDEELARLKRELARVKKERDFLREAATFFAKGSS*