Orf Name: Smlt0465
Type: Transposase


Previous Annotation: putative_transposase_for_IS_element

Borders:
putative D alanyl D alanine dipeptidase putative secreted protein <---> putative transmembrane protein


Protein fasta sequence
MFGIGIDVSKATLDVAVHGEQFRQFSNDKRGFVRLIRWLKTWPIKQVVLE
ASGGYERAALDVLHAAGLPMVRINPARARRFAQGTGRAAKTDRLDATVLA
QMAHLLPLTRYVPPAPWQQRLAEFAQCRRQLVQMRVSEMQRLRRLVDPDL
IAMKQRHIAQLSDDLKQLDKAIAEQLEGQPGWKNIGALKGVGPILISTLA
CELPELGSLGSKAIASLVGLAPMNRESGTWQGQRRISGGRAVVREALYMA
ALTAIRYEPRLRAFYAGLKAKGKASKVALVAVMRKMLVILNARKRDAEVA
LGCP*