Orf Name: Smlt0558
Type: Transposase


Previous Annotation: putative_transposase-related_protein

Borders:
hypothetical protein <---> hypothetical protein


Protein fasta sequence
MNHHKNARLTVHSRALLIRRILHEGLRPEEAAQACGVSVRTAYKWLARFR
QFGAPGLENRSSRPHQTPHATPAPVIEQIKEHRRKRQTYLTISKALGVGH
STISRLMRAHGLNRLCRLEPPKEVIRYEYDQPGGLLHLDIKKLGNFQRPG
HRTDAKRRGNAAGGGWGYVHVAIDDHSRVAFSSVHPNEQAETACQALLGA
LQYYASLGITFKRILTDNGACYRSTAFAKLLKSLGIKHIRTKPYTPRTNG
KAERFIQTSLREWAYAREYASSDQRNSVLTQWLHHYNWHRPHMGIGGQPP
ISRVLLNNVVGLHS*