Orf Name: Smlt0666
Type: Transposase


Previous Annotation: putative_transposase_protein

Borders:
putative transposase <---> putative transposase


Protein fasta sequence
MNGIGIDVSKRRLDIGTTDGQTLQVSNSPSGYAELSTWLSTRPAIQIVLE
ATGGYEQTVLDFLHKAGHPVIRANALRARRLAQGLGKVAKTDRLDALVLA
QMAALVELPSYQPLEPWQRKLREFVRARRQTMQALTVARQQQEMVTDREL
RRQMQGNIIRLQTLVERLGKQISEQVAQQPQLAVLKSMKGVGPALQAVLA
SYLPELGQISGKAIASLVGVAPISHDSGAMRGRRSIHGGRAEIRQVLYMA
AMSAMRHEPRLRDFYRSLRARGKEGKVAIVAVMRKMLVILNARVRDAENG
LVPA*