Orf Name: Smlt0808
Type: Transposase


Previous Annotation: putative_ISPsy9_like_transposase_integrase

Borders:
putative ISPsy9 like transposase <---> lemA


Protein fasta sequence
AAQGSRLSACGDRLPKKTRCLDPGRAGGARRKAQAIQGLRQVHTLSLLLE
AAELSRSTFYYQNHVLAHPDQDEAALCERIRAIYDQSQGRYGYRTVTLEL
ANQGHRTNHKRVQRLMGEMGLKSRVRVKRYRSFKGAANVVVGNDLNRQFH
AERPNQKWVTDVTEFKVQGMKLYLSPIMDLYNGEIVAYQIKRQPVFDLVG
QMLEEAIMKLSPDERPMIHSDQGWQYQHENYRHMLEKHSLKQSMSRRGNC
LDNAAMESFFGTLKSEFFYLNSFDSIESLEAGLVEYIQYYNQERIKLKLK
GLSPVEYRERAQSAA*