Orf Name: Smlt0835
Type: Transposase


Previous Annotation: putative_ISPsy9_like_transposase

Borders:
putative ISPsy9 like transposase <---> putative ISPsy9 like transposase


Protein fasta sequence
AAQGSRLSACGDRLPKKTRCLDPGRAGGARRKAQAIQGLRQVHTLSLLLE
AAELSRSTFYYQNHVLAHPDQDEAALCERIRAIYDQSKGRYGYRTVTLEL
ANQGHRTNHKRVQRLMGEMGLKSRVRVKRYRSFKGAANVVVGNDLNRQFH
AERPNQKWVTDVTEFKVQGMKLYLSPIMDLYNGEIVAYQIKRQPVFDLVG
QMLEEAIKKLSPDERPMIHSDQGWQYQHENYRHMLEKHSLKQSMSRRGNC
LDNAAMESFFGTLKSEFFYLNSFDNIESLEAGLVEYIQYYNQERIKLKLK
GLSPVEYRERAQSAA*