Orf Name: Smlt0836
Type: Transposase


Previous Annotation: putative_ISPsy9_like_transposase

Borders:
putative ISPsy9 <---> putative ISPsy9


Protein fasta sequence
MNRYDARFKLQVAKEACKTSTSVKAIARRHGLEFSTVRRWVATYRLHGWR
GFHRQARFYDLPFKLAVLEKMSQDGMSGREATTYFQIGDAGAVGRWRRLY
AQGGAQALAPPPPLPRKPMKKTRSSKPPEEMSRDELLKEVAYLRAETDYL
KKLDALIREEQAAQDAKRKPSKD*