Orf Name: Smlt1323
Type: Transposase


Previous Annotation: putative_transposase

Borders:
hypothetical protein <---> hypothetical protein


Protein fasta sequence
MEKEDARKQSREVLHERRKQVIRLHRKGVGVMQIVEQTGLSWSGVNTALR
LFEQGGAAALKPHARGKKPGSGRSLSTEQERVIRMTIIDKRPEQIKMEFA
LWSRPAVRELIERDLGNKLSVRAVGDYLARWGFTPQKSIKKAYEQRPEAV
QAWLEDEYPTIEARAKREGAEIHWGDETALVNTDVRGRSYAPAGQTPVTR
AVGGTRQKLSMIATVTNQGKTRWMIIDEAFNSDRLIEFMQALIKESQGKK
IFLILDNLRVHHSKPVKEWATQHKQDIELFYLPSYSPELNPEERLNADLK
HAIGSKVPVRTKAKLRAAATEHMTMLENTPERVKKYFGDKHVAYAAS*