Orf Name: Smlt1663
Type: Transposase


Previous Annotation: putative_ISXac3_like_transposase

Borders:
putative ISXac3 like element protein <---> putative transmembrane protein


Protein fasta sequence
MSTKRYTDEFKIEAVRQIVEYGRPVAEVAERLGVSIHSLYGWKRQQGKGD
VGRRVEQDQNAEVRRLKAELRRVTEERDILKKAAAYFAKG*