Orf Name: Smlt1733
Type: Transposase


Previous Annotation: putative_transposase

Borders:
hypothetical protein <---> folP


Protein fasta sequence
MNGIGIDVSKRRLDIGTTDGQTLQVSNSPSGYAELSTWLSTRPAIQIVLE
ATGGYEQTVLDFLHKAGHPVIRANALRARRLAQGLGKVAKTDRLDALVLA
QMAALVELPSYQPLEPWQRKLREFVRARRQTMQALTVARQQQEMVTDREL
RRQMQGNIIRLQTLVERLGKQISEQVAQQPQLAVLKSMKGVGPALQAVLA
SYLPELGQISGKAIASLVGVAPISHDSGAMRGRRSIHGGRAEIRQVLYMA
AMSAMRHEPRLRDFYRSLRARGKEGKVAIVAVMRKMLVILNARVRDAENG
LVPA*