Orf Name: Smlt1845
Type: Transposase


Previous Annotation: putative_ISXac3_like_transposase

Borders:
hypothetical protein <---> putative ISXac3 like element protein


Protein fasta sequence
MSTKRYTDEFKIEAVRQIVEYGRPVAEVAERLGVSIHSLYGWKRQQGKGD
VGRRVEQDQNAEVRRLKAELRRVTEERDILKKAAAYFAKG*