Orf Name: Smlt1846
Type: Transposase


Previous Annotation: putative_ISXac3_like_transposase_integrase

Borders:
hypothetical protein <---> hypothetical protein


Protein fasta sequence
RARHPKKSRRVLCKGVRAKYAFMKQHADEFGLAAMCRMLGVHRSGYYAWL
KEPASARDKDDQRLLGLIKHSWLESGSVYGHRKVTTDLRELGETCSRHRV
ARLMKSEGLRAMVGYGRRPRPLSGPVGSVAKNVLARGFKVSEPNRAWVTD
ITYIRTYDGFLYLAVVLDLFSRQVVGWATRPTQHTDLVLQALLAAVWRRK
PSPGLLLHSDQGTQFTSEDWQSFLREHDIVCSMSRRGNCHDNAAMESFFQ
LLKRERIKRRIYSNHDEARADVFQYIEMFYNPKRRHSSNDGLSPVEFEKQ
YALNG*