Orf Name: Smlt1878
Type: Transposase


Previous Annotation: putative_transposition_helper_protein

Borders:
hypothetical protein <---> putative transposase


Protein fasta sequence
MVSREIGVGVDTLERWRAESLARPAKERVWTAAARLEAVITTAAMDDASR
SAWCRENGVYAQQLQQWRDNAVRALAAPEQVRASPSQTKEDRRRIKELER
EVRRKDKALAEAAALLVLSKKAEAIFNRNKGEDE