Orf Name: Smlt1879
Type: Transposase


Previous Annotation: putative_transposase

Borders:
putative transposition helper protein <---> hypothetical protein


Protein fasta sequence
MIGLEDRQEIARDIEAACDAGARLKPACELMGISARTLQRWKAGQGLESG
DGRPQAVRPAPAHALSDRERAQIVSVANEPRFADLPPARIVPTLADEGVY
IASESSFRRVLRAQGQMSHRGRAKAPRKGRPPTTHVATAPRQLWCWDMTF
LPRDVAGRWFFLYLIMDVYSRKIVGFEVHEDDDWDHAARLVQRTALAEGI
HAMPRDERPVLHGDNGATLKATTVLAMLWWLGVKPSYSRPRVSDDNAFVE
SLFRTAKYRPEFPEKGFTDLCAAREWARQFVHWYNHDHRHSGIRYVSPAQ
RHEGHDVAILAARHQVYLQARERNPARWSRGTRDWSHIRAVTLNPERDSV
VTTAVSRGDIQPIAA