Orf Name: Smlt2253
Type: Transposase


Previous Annotation: putative_transposase

Borders:
No hits found <---> putative methyl accepting chemotaxis protein


Protein fasta sequence
MNGIGIDVSKRRLDIGTTDGQTLQVSNSPSGYAELSTWLSTRPAIQIVLE
ATGGYEQTVLDFLHKAGHPVIRANALRARRLAQGLGKVAKTDRLDALVLA
QMAALVELPSYQPLEPWQRKLREFVRARRQTMQALTVARQQQEMVTDREL
RRQMQGNIIRLQTLVERLGKQISEQVAQQPQLAVLKSMKGVGPALQAVLA
SYLPELGQISGKAIASLVGVAPISHDSGAMRGRRSIHGGRAEIRQVLYMA
AMSAMRHEPRLRDFYRSLRARGKEGKVAIVAVMRKMLVILNARVRDAENG
LVPA*