Orf Name: Smlt2291
Type: Transposase


Previous Annotation: putative_ISPsy9_like_transposase

Borders:
fliE <---> putative ISPsy9 like transposase for insertion sequence


Protein fasta sequence
MNRYDARFKLQVAKEACKTSTSVKAIARRHGLEFSTVRRWVATYRLHGWR
GFQRQAQFYDLPFKLAVLEKMSQDGMSGREATTYFQIGDAGAVGRWRRLY
AQGGAQALAPPPPLPRKPMKKTRSSKPPEEMSRDELLKEVAYLRAETDYL
KKLDALIREEQAAQDAKRKPSKD*