Orf Name: Smlt2292
Type: Transposase


Previous Annotation: putative_ISPsy9_like_transposase_for_insertion_sequence

Borders:
putative ISPsy9 like transposase <---> putative transmembrane protein


Protein fasta sequence
AAQGSRLSACGDRLPKKTRCLDPGRAGGARRKAQAIQGLRQVHTLSLLLE
AAELSRSTFYYQNHVLAHPDQDEAALCERIRAIYDQSQGRYGYRTVTLEL
ANQGHRTNHKRVQRLMGEMGLKSRVRVKRYRSFKGAANVVVGNDLNRQFH
AERPNQKWVTDVTEFKVQGMKLYLSPIMDLYNGEIVAYQIKRQPVFDLVG
QMLEEAIMKLSPDERPMIHSDQGWQYQHENYRHMLEKHSLKQSMSRRGNC
LDNAAMESFFGTLKSEFFYLNSFDSIESLEAGLVEYIQYYNQERIKLKLK
GLSPVEYRERAQSAA*