Orf Name: Smlt2328
Type: Transposase


Previous Annotation: putative_transposase

Borders:
putative transmembrane protein <---> putative methyl accepting chemotaxis protein


Protein fasta sequence
MFGIGIDVSKATLDVAVHGEQFRQFSNDKRGFVRLIRWLKTWPIKQVVLE
ASGGYERAALDVLHAAGLPMVRINPARARRFAQGTGRAAKTDRLDATVLA
QMAHLLPLTRYVPPAPWQQRLAEFAQCRRQLVQMRVSEMQRLRRLVDPDL
IAMKQRHIAQLSDDLKQLDKAIAEQLEGQPGWKNIGALKGVGPILISTLA
CELPELGSLGSKAIASLVGLAPMNRESGTWQGQRRISGGRAVVREALYMA
ALTAIRYEPRLRAFYAGLKAKGKASKVALVAVMRKMLVILNARKRDAEVA
LGCP*