Orf Name: Smlt2414
Type: Transposase


Previous Annotation: putative_ISXac3_like_transposase_for_insertion_sequence_element

Borders:
putative transposase <---> putative ISXac3 like transposase for insertion sequence element


Protein fasta sequence
MASKQYTDEFKAEAVKQVTERGFAVAEVAKRLGVSSHSLYQWLRKSRSEA
LAGTPEGSMLPTPKDSAEVRRLKAEVKRLTEERDILKK