Orf Name: Smlt2416
Type: Transposase


Previous Annotation: putative_insertion_sequence_protein

Borders:
putative ISXac3 like transposase for insertion sequence element <---> putative insertion element hypothetical protein


Protein fasta sequence
MTRRLDVKKRFSEEQIIGFLREAESGMPIKDLCRQHGFSEASYYLWRSKF
GGMSVPDAKRHKDLEAENTRLKKLLAEQVFENDVIKDALRKKW*