Orf Name: Smlt2417
Type: Transposase


Previous Annotation: putative_insertion_element_hypothetical_protein

Borders:
putative insertion sequence protein <---> putative monooxygenase


Protein fasta sequence
VRHAHQGPLPPAWLQRGLVLPVAQQVRRHERARRQAAQGSGGGEHTPEEA
AGRTGLRERRHQGCVAKKVVTAPARRLLVRSMVEKGLSERRALTVVRMSA
SALRYEPRPDNNVELREQIAALAHRHRRYGVGMIHLKLRQKGLVVNYKRV
ERLYQEAGLQVRRRKRKKVPVSERQPLLRPSAANEVWSMDFVFERTAEGR
VVKCLTIVDDATHEAVAIEVERAISGQGVSRVLDRLAMQRGLPRVIRTDN
GKEFCGKAMVAWAHEKEVALRLIEPGKPNQNAYIESFNGRLRDECLNEHW
FPTLLHARTSIESWRRDYNEERPKRALGGLTPAQYAAQLAAKNDNISTGL
*