Orf Name: Smlt2464
Type: Not determined yet


Previous Annotation: putative_phage_integrase

Borders:
putative TRANSCRIPTIONAL REGULATORY PROTEIN PROBABLY MERR FAMILY <---> tnpA


Protein fasta sequence
MTELDRYLDAATRQNTVRSYASALRHFEVEWQGHLPATPDSVARYLAAYA
QTLATSTLRQRLAAIASWHRDHGFVDPTRSPLVRKVLKGIQTLHPGQVKQ
AAPLQIRRLVELDDWLAAAIAAAHARGDGPAALRHQRDRALVLLGFWRGF
RGDELLRLDVAHLTLVPGQGMTCFLPRSKGDRQAAGVTYKVPALSRLCPV
EATQAWLQAADLQEGPVFRAVNQWGQVSAEGLHPNSLVRLLRELLTSAGF
ADAGLHSSHSLRRGFASWANDQGWDMKALMEYVGWRDVQSAMRYLDGRDP
FARDRIEASLPSPTVPVPAMALPAPEGKSALQLRLRMVLTPFARTGRGAA
KARGRIEEICLAPFQAVRLNTASSEYQLTAPTDPERDLDEILATLLDDMH
RMADTHQCFLEASLSTDDGRHWD