Orf Name: Smlt2465
Type: Transposase


Previous Annotation: tnpA

Borders:
putative phage integrase <---> hypothetical protein


Protein fasta sequence
MATLHETAYPRLKPDPTAKELEEIYTPTAAEIAFAKQLTTQPGPQLAVLI
HLKLFQRLGYFTLLADVPERIRKHIAKAARLGSVLDTDQLERYDASGSQR
RHMPQLRQFIGVRPLDKSGLAWLDTVATGAAQTKHTIPDIVNVLLEELVH
HRYELPGFRTLELAAIGARERVNLGYYRSISHALTPATRTLIDELLRAPE
GSRFTGWQSLKREPGRPTNKEVRFYLQHIRMLQQLADQLPPIDVPVPKLK
QFRAMARAYDASELAELAPDKRYALATIFIRAQHAKTLDDAAELFIKQVR
GLENTAQQKLLAYQLEHAKRADFLIGQLKEILQAYQLDGSDSQRVDAIDN
SLEAEVSTLLAECEEHMAYAGKNYLPFMLQPYGAVRPLLFNGLELMKLRA
TSHDAGMEPLIAAVLSLRNQRRELIEVASLGLDPEKDFDWMSKLWCQHVF
GKRASAAGAGWMHRKYFELAVLVQVKDELKSGDLFIPSSERFDDYREQLV
DEATLAQELEAYGQVSGLPTDAESFVAGLRAQLTSLADEVDARFPENVHA
DILDGRLVLRKGQRAEVSSAITTVDRLIAERLPESSIVDVLIDASQWLDL
HRFFRPIAGTESQVEDLPRRVITTPFCYGCNLGPTQTARSIKGFSRRQVA
WLNLKYVTEDVLEKAIVEVINTYNKFDLPGYWGSGKSASADGTKWSVYED
NLLSEYHIRYGGYGGIGYYHVSDKYVALFSHFIPCGVHEGIYILDGLLAN
TSDIQPEIVHGDTQAQSYPVFGLAHMLGIQLMPRIRNIKDLTFFRPEPGR
AYKNIQALFGDSIDWRLIATHLHDMLRVVISIRLGKITASSILRRLGTYS
RKNKLYFAFRELGKAVRTLFLLRYIDDNEIRKTIHAATNKSEEYNGFVKW
VFFGSQGIIAENVQHEQRKIIKYSQLVANMIILHNVEGMSRTLAEMRKEG
IELTPEILAGLSPYRTSHINRFGDYHLDLEREVAPLSYTAKVLEQTP