Orf Name: Smlt2478
Type: Transposase


Previous Annotation: putative_transposase_(pseudogene)

Borders:
putative transposase <---> putative transposase


Protein fasta sequence
AGQPAGRQLCPGGPGAGDPGCIADPLEAGGPEPGPGGLRWHRDAPGRGTG
AAQARAGPGEEGAGFFARSGDVLCQGIILRYQVIERCRDEFPVRLMCRCL
RVSASGYYDWSKRLPSARERDNQRLLGRIRELHEDSRGTLGAGRMHEDLA
EEGETASLNRVARLMATDGLQGWPRPKRRGQRGKPALTPPGVRNLLERDF
TALEPETRWVTDITELKTRQGKLYLCIVLDLFDQRVVGWSMHHRQDRQMV
IRAVQMAVWQRQGSHPLILHSDRGSQFRSGDYQRYLAANGLVCSMSAVGH
CGDNAACEGFFGLLKRERVYRMTYPTLDAARADVFEYIERFHNPRMRRRV
ARQDQKFSALLQPSVISG*