Orf Name: Smlt2479
Type: Transposase


Previous Annotation: putative_ISXac3_like_transposase

Borders:
putative transposase <---> hypothetical protein


Protein fasta sequence
MSKRRKFSTEFKRGAVEQASQPGVSCAQVARELGIRDALLTRWKREAQSR
GQVAFGGTGTPRDEELARLKRELARVKKERDFLREAATFFAKGSS*