Orf Name: Smlt2490
Type: Transposase


Previous Annotation: putative_ISXac3_like_transposase_family_protein

Borders:
putative ISXac3 like element protein <---> hypothetical protein


Protein fasta sequence
MSTKRYTDEFKIEAVRQIVEYGRPVAEVAERLGVSIHSLYGWKRQQGKGD
VGRRVEQDQNAEVRRLKAELRRVTEERDILKKAAAYFAKG*