Orf Name: Smlt2735
Type: Transposase


Previous Annotation: putative_transposase

Borders:
gspJ <---> putative glycine rich surface autotransporter protein


Protein fasta sequence
MFGIGIDVSKATLDVAVHGEQFRQFSNDKRGFVRLIRWLKTWPIKQVVLE
ASGGYERAALDVLHAAGLPMVRINPARARRFAQGTGRAAKTDRLDATVLA
QMAHLLPLTRYVPPAPWQQRLAEFAQCRRQLVQMRVSEMQRLRRLVDPDL
IAMKQRHIAQLSDDLKQLDKAIAEQLEGQPGWKNIGALKGVGPILISTLA
CELPELGSLGSKAIASLVGLAPMNRESGTWQGQRRISGGRAVVREALYMA
ALTAIRYEPRLRAFYAGLKAKGKASKVALVAVMRKMLVILNARKRDAEVA
LSCP*