Orf Name: Smlt3043
Type: Transposase


Previous Annotation: putative_ISXac3_like_transposase

Borders:
putative ISXac3 like transposase <---> hypothetical protein


Protein fasta sequence
GAGSGVSRICWCRDAPGRGACAVEARTSPGEEGAGFFARSGDVLCQGIIL
RYQVIERCRDEFPVRLMCRCLKVSASGYYDWSKRLPSAGQLENQRLLDQI
RALHEDSRGTLGAGRMQEDLADAGHSLSLNRVARLMAADGLQGWPRPKRR
GQQGRPALTLPGVRNRLERDFSALEPETKWVTDITEIKTQQSKLYLCIVL
DLFDQRVVGWSMQHRQDRQMVIRAVQMAVWQRQESYEVILHSDRGTQFRS
GDYQRYLAANSLVCSMSAVGHCGDNAACEGFFGLLKRERIYRTSYPTLDA
ARADVFDYIERRHNPRMRRRVARQDQKVAALLEPSVISG*