Orf Name: Smlt3544
Type: Transposase


Previous Annotation: putative_ISPsy9_transposase_orfa

Borders:
putative two component regulator response regulator transcriptional <---> putative ISPys9 like transposase


Protein fasta sequence
MNRYDARFKLQVAKEACKTSTSVKAIARRHGLEFSTVRRWVATYRLHGWR
GFHRQARFYDLPFKLAVLEKMSQDGMSGREATTYFQIGDAGAVGRWRRLY
AQGGAQALAPPPPLPRKPMKKTRSSKPPEEMSRDELLKEVAYLRAETDYL
KKLDALIREEQAAQDAKRKPSKD*