Orf Name: Smlt3545
Type: Transposase


Previous Annotation: putative_ISPys9_like_transposase

Borders:
putative ISPsy9 <---> hypothetical protein


Protein fasta sequence
AAQGSRLSACGDRLPKKTRCLDPGRAGGARRKAQAIQGLRQVHTLSLLLE
AAELSRSTFYYQNHVLAHPDQDEAALCERIRAIYDQSQGRYGYRTVTLEL
ANQGHRTNHKRVQRLMGEMGLKSRVRVKRYRSFKGAANVVVGNDLNRQFH
AERPNQKWVTDVTEFKVQGMKLYLSPIMDLYNGEIVAYQIKRQPVFDLVG
QMLEEAIKKLSPDERPMIHSDQGWQYQHENYRHMLEKHSLKQSMSRRGNC
LDNAAMESFFGTLKSEFFYLNSFDSIESLEAGLVEYIQYYNQERIKLKLK
GLSPVEYRERAQSAA*