Orf Name: Smlt3573
Type: Transposase


Previous Annotation: putative_transposase

Borders:
putative transmembrane sulfatase <---> putative angiotensin converting enzyme like peptidyl dipeptidase pr


Protein fasta sequence
MNGIGIDVSKRRLDIGTTDGQTLQVSNSPSGYAELSTWLSTRPAIQIVLE
ATGGYEQTVLDFLHKAGHPVIRANALRARRLAQGLGKVAKTDRLDALVLA
QMAALVELPSYQPLEPWQRKLREFVRARRQTMQALTVARQQQEMVTDREL
RRQMQGNIIRLQTLVERLGKQISEQVAQQPQLAVLKSMKGVGPALQAVLA
SYLPELGQISGKAIASLVGVAPISHDSGAMRGRRSIHGGRAEIRQVLYMA
AMSAMRHEPRLRDFYRSLRARGKEGKVAIVAVMRKMLVILNARVRDAENG
LVPA*