Orf Name: Smlt4369
Type: Transposase


Previous Annotation: putative_transposase

Borders:
putative transposase <---> putative transposase


Protein fasta sequence
MNHHKNARLTPFSRELLVRRITEQGLRPEEAAQACGVSVRTAYKWLARYR
AEGLIGLQNRSSRPSRSPHGTPEALVEQIVQRRRQRQTYLTISKALGVAH
STISRLMRRRGLNRLCLLDPPKKAVRYEYDSPGGLLHLDIKKLGNFHRPG
HRVDPNRRGNAGGGGWGYVHVAIDDHSRVAFSSVHTDEKGSTACQALLAA
LAYYKTLGVTFQRVLTDNGACYRSGVFARLVASLGMKHYRTKPYTPRTNG
KAERFIQTSLREWAYACEYASSEQRDAVLPEWLHYYNWHRPHMGIGSQPP
ISRIPLNNVVGLHN*